PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02650.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 297aa    MW: 33995.2 Da    PI: 9.5904
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02650.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.7e-1456102147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg W   Ed +l ++v+ +G+ +W+ Ia++m+ +Rt+k+c++rw++ 
  Rsa1.0_02650.1_g00002.1  56 RGHWRISEDSQLMELVAVYGPQNWNHIAEKMQGRRTGKSCRLRWFNQ 102
                              789999**************************9***********996 PP

2Myb_DNA-binding47.25e-15110153247
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +++ eE+e+l+ a++ +G++ W+ Ia+ +  gRt++ +k++w+ +
  Rsa1.0_02650.1_g00002.1 110 RAFSVEEEERLLAAHRAFGSK-WAMIAKLFD-GRTDNALKNHWHVL 153
                              689******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.9351103IPR017930Myb domain
SMARTSM007173.1E-1055105IPR001005SANT/Myb domain
SuperFamilySSF466891.05E-2555150IPR009057Homeodomain-like
PfamPF002497.7E-1456102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2257110IPR009057Homeodomain-like
CDDcd001678.17E-959101No hitNo description
PROSITE profilePS5129424.044104158IPR017930Myb domain
SMARTSM007177.0E-12108156IPR001005SANT/Myb domain
PfamPF002492.1E-11110153IPR001005SANT/Myb domain
CDDcd001671.93E-8111154No hitNo description
Gene3DG3DSA:1.10.10.607.6E-19111158IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MDFSCFQEYP FDLQCRGAFN GFGENKAVEF SNKRSMLKKS DEFKKKQRGS SRGCSRGHWR  60
ISEDSQLMEL VAVYGPQNWN HIAEKMQGRR TGKSCRLRWF NQLDPRINKR AFSVEEEERL  120
LAAHRAFGSK WAMIAKLFDG RTDNALKNHW HVLMARKLRQ QSTSYLRSIN EYAYNPTSDK  180
KTFNIPPGTV DGEAMNLEKN SWETLKEYTT NLKAQYLQEE YCSSRMPMQG PHHHCSTFPA  240
DSLALTLQPS SPSLSASSSS SSSSSSAEHR VVARYFETTK PPAFIDFLGV GYQNPNI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-28561584105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013665076.10.0PREDICTED: myb-related protein MYBAS1-like
TrEMBLA0A078JI421e-179A0A078JI42_BRANA; BnaCnng49790D protein
STRINGBra033078.1-P1e-154(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63001846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G29020.21e-138myb domain protein 110